Tesa (10mg)
$90.00 Original price was: $90.00.$68.00Current price is: $68.00.
Chemical Information:
- Molecular Formula: C₂₂₃H₃₇₀N₇₂O₆₉S
- Molecular Weight: 5195.9 g/mol
- Sequence: YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL
- Molecular Structure: Refer to Certificate of Analysis for detailed structural information.
Description:
Tesamorelin is a synthetic peptide analog of growth hormone-releasing hormone (GHRH), extensively studied for its potential to stimulate endogenous growth hormone (GH) release. By mimicking natural GHRH activity, Tesamorelin supports anabolic pathways and metabolic regulation, making it a valuable research tool in studies examining growth hormone secretion, fat metabolism, and cellular regeneration. Supplied in lyophilized powder form, Tesamorelin is suitable for advanced laboratory research exploring growth hormone modulation, metabolic health, and tissue regeneration.
Research Applications:
Tesamorelin is actively studied for potential roles in:
- Stimulating Growth Hormone Release: Investigating mechanisms for increasing endogenous GH production.
- Metabolic Research: Examining its effects on visceral fat reduction, lipid metabolism, and overall metabolic function.
- Muscle and Lean Mass Studies: Exploring its influence on muscle protein synthesis, anabolic pathways, and lean mass maintenance.
- Neurocognitive Research: Assessing possible impacts on cognitive functions and neuroprotection related to GH modulation.
Storage and Handling:
- Store lyophilized powder at -20°C.
- After reconstitution, refrigerate at 2-8°C and use promptly.
- Maintain aseptic handling practices to ensure sterility and product integrity.
Product Specifications:
- Purity: ≥99% (HPLC Verified)
- Appearance: Lyophilized white powder
- Solubility: Soluble in bacteriostatic water
Important Note:
This product is strictly FOR RESEARCH USE ONLY and is intended exclusively for in vitro research and laboratory experimentation by qualified professionals. It is not a drug, food, cosmetic, or dietary supplement, and has not been evaluated by the FDA. This peptide is not intended to diagnose, treat, cure, or prevent any disease. The bodily introduction into humans or animals is strictly prohibited by law. Any misuse, misbranding, or mislabeling is a violation of federal regulations and may result in legal action under applicable federal, state, or local laws.
References:
Referenced scientific publications include:
- Falutz, J., et al. (2007). “Effects of Tesamorelin on Visceral Fat and Metabolism in Clinical Studies.” Journal of Endocrinology and Metabolism.
- Johansen, K. L., et al. (2010). “Growth Hormone-Releasing Peptides and Their Role in Metabolic Research.” Metabolism Research Reviews.
Categories: GHRH/GRHP
You may also like
$82.00 Original price was: $82.00.$64.00Current price is: $64.00.



