You are here:
GLP, GIP, Glcgn & Amylin Analogs COA Verified 🇺🇸 Made in USA
Research Peptide · GLP, GIP, Glcgn & Amylin Analogs
Cagrilinitide (5mg)
≥99% HPLC Purity
Third-party testedLyophilized
$65.00
In stock · ships same-day before 2 PM PT
Secure encrypted checkout
FedEx 2Day shipping
Discreet packaging
Free shipping $150+
Certificate of Analysis
Lot #262702 · Purity and ID · HPLC
Product Details
Chemical Information
Molecular Formula C₁₇₄H₂₇₆N₅₂O₅₅
Molecular Weight 3946.32 g/mol
Sequence
KCNTATCATQRLANFLVHSSNNFGAILSSTNVGSNTY-NH₂
Molecular Structure Refer to Certificate of Analysis for detailed structural information.
Product Specifications
Purity ≥99% (HPLC Verified)
Appearance Lyophilized white powder
Solubility Soluble in bacteriostatic water
Storage and Handling
Store lyophilized powder at -20°C.
After reconstitution, refrigerate at 2-8°C and use promptly.
Maintain aseptic handling practices to ensure sterility and product integrity.
For Research Use Only
This product is strictly FOR RESEARCH USE ONLY and is intended exclusively for in vitro research and laboratory experimentation by qualified professionals. It is not a drug, food, cosmetic, or dietary supplement, and has not been evaluated by the FDA. This peptide is not intended to diagnose, treat, cure, or prevent any disease. The bodily introduction into humans or animals is strictly prohibited by law. Any misuse, misbranding, or mislabeling is a violation of federal regulations and may result in legal action under applicable federal, state, or local laws.