You are here:

Cagrilinitide (5mg)

Original price was: $120.00.Current price is: $65.00.

Chemical Information:

  • Molecular Formula: C₁₇₄H₂₇₆N₅₂O₅₅
  • Molecular Weight: 3946.32 g/mol
  • Sequence: KCNTATCATQRLANFLVHSSNNFGAILSSTNVGSNTY-NH₂ (Modified for prolonged half-life and enhanced receptor affinity)
  • Molecular Structure: Refer to Certificate of Analysis for detailed structural information.

Description:
Cagrilintide is a synthetic long-acting analog of human amylin, a peptide extensively studied for its potential roles in appetite regulation, energy balance, and metabolic control. Engineered for prolonged receptor activation, Cagrilintide supports research into mechanisms governing satiety, food intake, weight management, and metabolic signaling pathways. Provided as a lyophilized powder, it is ideal for advanced research into metabolic function, energy homeostasis, and obesity-related pathways.


Research Applications:
Cagrilintide is actively studied for potential roles in:

  • Appetite and Weight Regulation: Investigating effects on food intake suppression and satiety signaling pathways.
  • Metabolic Control: Evaluating impacts on glucose metabolism, insulin sensitivity, and lipid profile improvements.
  • Obesity Research: Examining mechanisms underlying sustained weight loss and energy balance modulation.
  • Gastrointestinal and Neuroendocrine Studies: Exploring interactions with gastrointestinal motility, nutrient absorption, and central signaling pathways involved in hunger and satiety.

Storage and Handling:

  • Store lyophilized powder at -20°C.
  • After reconstitution, refrigerate at 2-8°C and use promptly.
  • Maintain aseptic handling practices to ensure sterility and product integrity.

Product Specifications:

  • Purity: ≥99% (HPLC Verified)
  • Appearance: Lyophilized white powder
  • Solubility: Soluble in bacteriostatic water

Important Note:
This product is strictly FOR RESEARCH USE ONLY and is intended exclusively for in vitro research and laboratory experimentation by qualified professionals. It is not a drug, food, cosmetic, or dietary supplement, and has not been evaluated by the FDA. This peptide is not intended to diagnose, treat, cure, or prevent any disease. The bodily introduction into humans or animals is strictly prohibited by law. Any misuse, misbranding, or mislabeling is a violation of federal regulations and may result in legal action under applicable federal, state, or local laws.


References:
Referenced scientific publications include:

  • Lau, D. C., et al. (2021). “Cagrilintide, a Long-Acting Amylin Analogue, for Weight Management in Adults with Overweight and Obesity: A Randomised, Controlled, Phase 2 Trial.” The Lancet.
  • Enebo, L. B., et al. (2021). “Safety, Tolerability, and Efficacy of Cagrilintide for Weight Management: Findings from a Phase 1 Clinical Study.” Diabetes, Obesity and Metabolism.
Categories:

You may also like

Reviews (no reviews yet)