You are here:

Cagrilinitide (5mg)

$65.00

Free Shipping on Orders Over $150!
  • Exceeds GMP Standards
  • Fast FedEx 2-Day Shipping (Mon–Fri)
  • Secure Payments
  • Same-Day Dispatch Before 2 PM PST

Chemical Information:

  • Molecular Formula: C₁₇₄H₂₇₆N₅₂O₅₅
  • Molecular Weight: 3946.32 g/mol
  • Sequence: KCNTATCATQRLANFLVHSSNNFGAILSSTNVGSNTY-NH₂ (Modified for prolonged half-life and enhanced receptor affinity)
  • Molecular Structure: Refer to Certificate of Analysis for detailed structural information.

Storage and Handling:

  • Store lyophilized powder at -20°C.
  • After reconstitution, refrigerate at 2-8°C and use promptly.
  • Maintain aseptic handling practices to ensure sterility and product integrity.

Product Specifications:

  • Purity: ≥99% (HPLC Verified)
  • Appearance: Lyophilized white powder
  • Solubility: Soluble in bacteriostatic water

Important Note:
This product is strictly FOR RESEARCH USE ONLY and is intended exclusively for in vitro research and laboratory experimentation by qualified professionals. It is not a drug, food, cosmetic, or dietary supplement, and has not been evaluated by the FDA. This peptide is not intended to diagnose, treat, cure, or prevent any disease. The bodily introduction into humans or animals is strictly prohibited by law. Any misuse, misbranding, or mislabeling is a violation of federal regulations and may result in legal action under applicable federal, state, or local laws.

You may also like