Tesa (10mg)

≥99% HPLC Purity Third-party testedLyophilized

$68.00

In stock · ships same-day before 2 PM PT

Secure encrypted checkout

FedEx 2Day shipping

Discreet packaging

Free shipping $150+

Certificate of Analysis

Lot #262702 · Purity and ID · HPLC

View COA

Product Details

Chemical Information

Molecular Formula C₂₂₃H₃₇₀N₇₂O₆₉S

Molecular Weight 5195.9 g/mol

Sequence

YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL

Molecular Structure Refer to Certificate of Analysis for detailed structural information.

Product Specifications

Purity ≥99% (HPLC Verified)

Appearance Lyophilized white powder

Solubility Soluble in bacteriostatic water

Storage and Handling

Store lyophilized powder at -20°C.

After reconstitution, refrigerate at 2-8°C and use promptly.

Maintain aseptic handling practices to ensure sterility and product integrity.

For Research Use Only

This product is strictly FOR RESEARCH USE ONLY and is intended exclusively for in vitro research and laboratory experimentation by qualified professionals. It is not a drug, food, cosmetic, or dietary supplement, and has not been evaluated by the FDA. This peptide is not intended to diagnose, treat, cure, or prevent any disease. The bodily introduction into humans or animals is strictly prohibited by law. Any misuse, misbranding, or mislabeling is a violation of federal regulations and may result in legal action under applicable federal, state, or local laws.

Read the Tesa research page — purity, specs & sourcing →