For laboratory and research use only. Not for human or animal consumption.
For laboratories sourcing Tesa, what matters is verifiable identity, purity, and documentation. Every EvoLabs Tesa lot is HPLC-verified to ≥99% and ships with a third-party Certificate of Analysis.
Product Identity
Tesa is supplied as a lyophilized white powder for laboratory research use.
Molecular Profile
| Molecular Formula | C₂₂₃H₃₇₀N₇₂O₆₉S |
| Molecular Weight | 5195.9 g/mol |
| Amino-Acid Sequence | YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL |
| Purity | ≥99% (HPLC Verified) |
| Appearance | Lyophilized white powder |
Quality & Verification
Every lot is analyzed by reverse-phase HPLC for purity and confirmed by mass spectrometry for molecular identity, with a signed third-party Certificate of Analysis included on every order. How to read a COA →
Handling, Storage & Reconstitution
Store the lyophilized powder at -20°C. Where research calls for reconstitution, bacteriostatic water is the standard diluent; refrigerate the reconstituted solution. EvoLabs stocks BAC Water.
Sourcing Tesa
Manufactured domestically in cGMP / ISO-certified facilities, HPLC-verified every batch, with a COA on every order and same-day dispatch before 2 PM PST. View Tesa →
Frequently Asked Questions
Is your Tesa third-party tested? Yes — HPLC-verified to ≥99%, with a COA on every order.
What form does it ship in? A lyophilized white powder.
Where is it manufactured? In the USA, in cGMP/ISO-certified facilities.
Do you provide documentation? A signed Certificate of Analysis is included with every order.
All EvoLabs products are sold strictly for laboratory research use only and are not intended for human or animal consumption.
