You are here:
Cellular Research COA Verified 🇺🇸 Made in USA
Research Peptide · Cellular Research
Tesa (10mg)
≥99% HPLC Purity
Third-party testedLyophilized
$68.00
In stock · ships same-day before 2 PM PT
15%OFF
BULK PRICING · SAVE 15%
Buy 10, save $102.00.
$57.80 each was $68.00
· stacks with coupons
See full breakdown
| 1–9 units | $68.00 each |
| 10+ units | $57.80 each · save 15% |
Secure encrypted checkout
FedEx 2Day shipping
Discreet packaging
Free shipping $150+
Certificate of Analysis
Lot #262702 · Purity and ID · HPLC
Product Details
Chemical Information
Molecular Formula C₂₂₃H₃₇₀N₇₂O₆₉S
Molecular Weight 5195.9 g/mol
Sequence
YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL
Molecular Structure Refer to Certificate of Analysis for detailed structural information.
Product Specifications
Purity ≥99% (HPLC Verified)
Appearance Lyophilized white powder
Solubility Soluble in bacteriostatic water
Storage and Handling
Store lyophilized powder at -20°C.
After reconstitution, refrigerate at 2-8°C.
Maintain aseptic handling practices to ensure sterility and product integrity.
For Research Use Only
This product is strictly FOR RESEARCH USE ONLY and is intended exclusively for in vitro research and laboratory experimentation by qualified professionals. It is not a drug, food, cosmetic, or dietary supplement, and has not been evaluated by the FDA. This peptide is not intended to diagnose, treat, cure, or prevent any disease. The bodily introduction into humans or animals is strictly prohibited by law. Any misuse, misbranding, or mislabeling is a violation of federal regulations and may result in legal action under applicable federal, state, or local laws.